PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DL_26A958CDD.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 224aa    MW: 24191.2 Da    PI: 9.8569
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DL_26A958CDD.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.4e-171461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg+WT  Ede l+ +vk +G g+Wk ++ + g++R++k+c++rw++yl
  Traes_4DL_26A958CDD.1 14 RGAWTSKEDETLASYVKAHGEGRWKQVPLKAGLRRCGKSCRLRWLNYL 61
                           89********************************************97 PP

2Myb_DNA-binding51.91.7e-1667111147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rg+ + +E+el+v+++++lG++ W++Ia +++ gRt++++k++w++ 
  Traes_4DL_26A958CDD.1  67 RGNISDDEEELIVRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNST 111
                            7899******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.353961IPR017930Myb domain
SuperFamilySSF466893.63E-2811108IPR009057Homeodomain-like
SMARTSM007171.2E-121363IPR001005SANT/Myb domain
PfamPF002491.6E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-231568IPR009057Homeodomain-like
CDDcd001671.80E-91661No hitNo description
PROSITE profilePS5129425.04262116IPR017930Myb domain
SMARTSM007175.8E-1566114IPR001005SANT/Myb domain
PfamPF002493.0E-1467111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-2369115IPR009057Homeodomain-like
CDDcd001671.36E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006633Biological Processfatty acid biosynthetic process
GO:0006970Biological Processresponse to osmotic stress
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MGRRAWSAKE GVKRGAWTSK EDETLASYVK AHGEGRWKQV PLKAGLRRCG KSCRLRWLNY  60
LRPSIKRGNI SDDEEELIVR LHRLLGNRWS LIAGRLPGRT DNEIKNYWNS TLGRKALPER  120
SATRMVSTPC ASPGSVSSNS GAATSSNAAT PPLSAAVWAP KPVRCTGGLF FHGDARAVGG  180
DGDECSGSSL VASSGGGDWM DDVRALASFL ESDDDWVNSL QMAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3589370.0AK358937.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1086B18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002436658.11e-85hypothetical protein SORBIDRAFT_10g006700
SwissprotP102902e-77MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLW5EG131e-162W5EG13_WHEAT; Uncharacterized protein
STRINGGRMZM2G701063_P015e-87(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.14e-56MYB family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]